PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Traes_2AL_189D6889B.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Triticodae; Triticeae; Triticinae; Triticum
Family Dof
Protein Properties Length: 378aa    MW: 38347.6 Da    PI: 8.4721
Description Dof family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Traes_2AL_189D6889B.1genomeIWGSCView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1zf-Dof124.92.6e-3979140263
                 zf-Dof   2 kekalkcprCdstntkfCyynnyslsqPryfCkaCrryWtkGGalrnvPvGggrrknkksss 63 
                            keka++cprC+stntkfCyynnysl+qPryfCk+CrryWt+GG+lrnvPvGgg+rknk+sss
  Traes_2AL_189D6889B.1  79 KEKAINCPRCNSTNTKFCYYNNYSLQQPRYFCKTCRRYWTEGGSLRNVPVGGGSRKNKRSSS 140
                            7899******************************************************9875 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
ProDomPD0074783.0E-3176137IPR003851Zinc finger, Dof-type
PfamPF027013.6E-3381137IPR003851Zinc finger, Dof-type
PROSITE profilePS5088428.90183137IPR003851Zinc finger, Dof-type
PROSITE patternPS01361085121IPR003851Zinc finger, Dof-type
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0009639Biological Processresponse to red or far red light
GO:0009845Biological Processseed germination
GO:0005634Cellular Componentnucleus
GO:0044212Molecular Functiontranscription regulatory region DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 378 aa     Download sequence    Send to blast
MDAAHWPQGL GLVKPMEEML MGAPSSNQQV QGSNPNPPAQ APSSAPGAGG PMRGGTPAMA  60
VAASGVGAGS TERRPRPQKE KAINCPRCNS TNTKFCYYNN YSLQQPRYFC KTCRRYWTEG  120
GSLRNVPVGG GSRKNKRSSS SSASASASAA ASATASVANS SMLGAAPNKN PKLAHEGAAH  180
DLNLAFPHHQ GGMQAQADYM AFPSLESSSM CNPGGGGMAA NGARAGGALS AMELLRSTGC  240
YMPLQMPMQM PGEYGAAGFS LGEFRAPAPP QSQSLLGFSL DAHGSVGGAS MAGYGSGAGM  300
QGMQDRSGRL LFAFEDLKPT ANSGAGGGES GGGSGAGVDG GDHQFEQGNK EQQGNGTPVG  360
QPDTPGFWNG MIGGGGTW
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1322333SGAGGGESGGGS
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAK3721170.0AK372117.1 Hordeum vulgare subsp. vulgare mRNA for predicted protein, complete cds, clone: NIASHv2146K16.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_003580343.11e-136PREDICTED: dof zinc finger protein DOF4.6-like
TrEMBLW5APX20.0W5APX2_WHEAT; Uncharacterized protein
STRINGMLOC_68844.20.0(Hordeum vulgare)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP23693486
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G61850.42e-42Dof family protein
Publications ? help Back to Top
  1. Brenchley R, et al.
    Analysis of the bread wheat genome using whole-genome shotgun sequencing.
    Nature, 2012. 491(7426): p. 705-10
    [PMID:23192148]